ChemBK
  • Home
  • Product Category


SALMON

calcitonin

CAS: 9007-12-9

Molecular Formula: C145H240N44O48S2

  1. Home
  2. Product Category
  3. other
  4. other
  5. SALMON

SALMON - Names and Identifiers

Name calcitonin
Synonyms SALMON
calcitar
calcitrin
calcitonin
calcimar(salmon)
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2
CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2
CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2 SALMON
CAS 9007-12-9
EINECS 232-693-2

SALMON - Physico-chemical Properties

Molecular FormulaC145H240N44O48S2
Molar Mass3431.85
Solubility 0.05 M acetic acid: 1mg/mL, clear, colorless
Appearancepowder
Storage Condition−20°C
Physical and Chemical PropertiesThis product is a single chain polypeptide composed of 32 amino acid residues extracted or synthesized by pig thyroid, eel heart, etc. The N-terminal is cysteine, A disulfide bond is formed with cysteine at position 7, and the C- terminus is prolinamide. White powder or white powder, soluble in water and alkali, insoluble in acetone, ethanol, chloroform and ether, insoluble in inorganic acid solution. Its viability can be disrupted by trypsin, chymotrypsin, pepsin, polyphenol oxidase, hydrogen peroxide oxidation, photooxidation and N-bromosuccinimide.
UseRegulates calcium metabolism, inhibits the parathyroid hormone!

SALMON - Risk and Safety

Safety DescriptionS22 - Do not breathe dust.
S24/25 - Avoid contact with skin and eyes.
WGK Germany3
RTECSEV8000000
FLUKA BRAND F CODES3-10

SALMON - Nature

Open Data Verified Data
  • calcitonin can be extracted from pig thyroid, eel heart, etc., or synthetic, is a 32 peptide. Porcine calcitonin is white powder or white powder, soluble in water and alkali, insoluble in acetone, ethanol, chloroform, ether, insoluble in inorganic acid solution. Its activity can be disrupted by trypsin, chymotrypsin, pepsin, polyphenol oxidase, etc. It is also possible to destroy its viability by oxidation or by acting on N-bromosuccinimide.
  • It is a polypeptide hormone that regulates blood calcium concentration and is secreted by the parafollicular cells in the thyroid gland, or C- cells for short. A disulfide bond is formed between the N-terminal cysteine and the cysteine at position 7. The C- terminus is prolinamide. If prolinamide is removed, the activity is completely lost. In nature, calcitonin widely exists in a variety of animals, such as humans and mammals, mainly in the thyroid, parathyroid, thymus and adrenal gland and other tissues, fish in salmon, eel, the content of the final Gill of trout is more. Calcitonin obtained from salmon has a 20-to 50-fold higher calcium-lowering effect in humans than is isolated from other mammals. The sequence of the amino acids of calcitonin varies among different animal sources.
  • its main effect is to reduce blood calcium through the regulation of bone, kidney and gastrointestinal tract. It can inhibit bone resorption and bone autolysis, reduce the calcium released by bones, and at the same time, the bones continuously absorb calcium in plasma, resulting in a decrease in blood calcium. On the other hand, it also inhibits the dissolution and metastasis of bone salts, inhibits the decomposition of bone matrix, and increases the excretion of urinary calcium and phosphorus. It increases the excretion of calcium, phosphorus and sodium in the urine by inhibiting the reabsorption of renal tubules, but the serum calcium can be kept in the normal range. This product can reduce the secretion of stomach and pancreas, but does not affect the gastrointestinal activity.
Last Update:2024-01-02 23:10:35

SALMON - Preparation Method

Open Data Verified Data

The pig thyroid was minced, 2 to 3 times the volume of acetone was added, defatted with sufficient stirring, and centrifuged. Add 4 to 5 times the volume of 0. 1mol/L hydrochloric acid, heat and stir th, then add 1 times the volume of water, mix, stir th, centrifuge, precipitate, wash with water, combine supernatant and wash, stir for 2H, centrifuge, the supernatant was collected. Add 1/3~1/2 volume of isoamyl alcohol: acetic acid: water (volume ratio 20:32:48) mixture to the supernatant, stir, heat to 50 °c, the precipitate was collected by filtration with diatomaceous earth as a filter aid. The precipitate was further dissolved in 0. 3mol/L sodium chloride, and adjusted to pH 10% with 2.5 hydrochloric acid. The insoluble matter was removed by centrifugation, and the centrifuged liquid was collected. After diluting the centrifuged solution with 10-fold water, a CM-cellose column was added and eluted with dilute acetic acid solution. The eluate containing the calcitonin component was collected, concentrated under reduced pressure and lyophilized to obtain a powder, and the finished calcitonin was obtained.

Last Update:2022-01-01 11:11:55

SALMON - Application

Open Data Verified Data
  • for osteoporosis with bone pain, hypercalcemia and its crisis, secondary to breast, lung, kidney and other malignant tumors caused by tumorous osteolysis, osteoarthritis, neurodystrophy and calcium, disorders of phosphorus metabolism such as hypercalcemia, hyperphosphatemia, ulcer disease, acute pancreatitis, etc. Also used in the diagnosis of thyroid and medullary cell carcinoma, lung cancer.
  • usage and dose of subcutaneous, intramuscular, intravenous injection, porcine calcitonin, 40~60 units per day; Synthetic salmon calcitonin is 5 ~ lOIU/kg.d, add 500ml physiological saline slowly drip, 6 hours drip, or 2~4 times slowly intravenous injection. Chronic hypercalcemia long-term treatment, General subcutaneous or intramuscular injection. Bone pain with osteolysis: Daily 100 ~ 2001U, intravenous infusion or intramuscular, subcutaneous injection 1~2 times. Osteoplastic, 1001U injected subcutaneously or intramuscularly daily or every other day for a minimum of 3 consecutive months. Postmenopausal osteoporosis, lOOIU/d, subcutaneous or intramuscular injection. Neurodystrophic disease, 10 01U subcutaneous or intramuscular injection daily for 2-4 weeks, adjusted to 3 times per week after 6 weeks; Acute pancreatitis, 3001U/time, 24H slow intravenous infusion, 6 consecutive days. If necessary, the course of treatment can be prolonged.
Last Update:2025-08-19 16:24:40

SALMON - Safety

Open Data Verified Data
  • Nausea, occasionally Vomit, mild facial flushing with sensation of heat. Rare allergic reaction. Bedridden patients with long-term treatment, at least once a month to check the urinary sediment. The treatment of osteoarthritis and other chronic diseases with high bone age turnover should be maintained for several months to several years, and the withdrawal or continuation of treatment should be decided according to the blood alkaline phosphatase and urinary hydroxyproline excretion. Children's medication, treatment should not be more than a few weeks.
  • protected from light and stored at room temperature.
Last Update:2022-01-01 11:11:56
SALMON
Supplier List
View History
SALMON
Hydroxyethylurea
DeMulsifier
CAC
TRIMETHYLAMMONIUM-3-TOLYL-EPSILON-CAPROLACTIMIDECHLORIDE
FLEURAMONE
分散剂NNO
562-90-3
  • Home
  • Product Category

© 2015, 2023 ChemBK.com All Rights Reserved | Build: 20230617001