CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2
Calcitonin, eel
CAS: 57014-02-5
Molecular Formula: C146H241N43O47S2
CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 - Names and Identifiers
CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 - Physico-chemical Properties
| Molecular Formula | C146H241N43O47S2 |
| Molar Mass | 3414.91 |
| Density | 1.52±0.1 g/cm3(Predicted) |
| Storage Condition | −20°C |
| MDL | MFCD00133858 |
CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 - Risk and Safety
| WGK Germany | 3 |
CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 - Introduction
Calcitonin (Calcitonin) is a peptide hormone produced by thyroid C cells. It is mainly used to regulate the level of calcium ions in the body, inhibit the release of calcium in the bones, thereby reducing the blood calcium concentration.
For eel (eel), it is an aquatic animal with the following properties:
1. Eel belongs to vertebrates, the body is long and slender shape.
2. Its skin is slimy and covered with mucus, which helps to move in water.
3. Eel has an electric induction organ, which can sense the weak electric field in the surrounding environment.
The use of Calcitonin:
1. For the treatment of osteoporosis: Calcitonin can slow down the rate of bone loss by inhibiting the activity of bone resorption cells in the bone, and increase bone density to a certain extent.
2. For the treatment of hypercalcemia: Calcitonin can inhibit the release of calcium ions in the body, reduce the release of calcium in the bones into the blood, thereby reducing the blood calcium concentration.
3. For the treatment of hyperparathyroidism: Calcitonin can inhibit parathyroid secretion of parathyroid hormone, thereby regulating the level of calcium ions in the body.
The preparation method of Calcitonin can be obtained by artificial synthesis, or extracted and purified from the thyroid gland of animals (such as pigs and cattle).
Regarding the safety information of Calcitonin, long-term use of higher doses of Calcitonin may cause some side effects, such as facial flushing, headache, nausea and vomiting. For specific patients, such as pregnant women, lactating women and the presence of other diseases, should be used with caution. It is recommended to use Calcitonin under the guidance of a professional doctor and follow its accurate usage and precautions.
For eel (eel), it is an aquatic animal with the following properties:
1. Eel belongs to vertebrates, the body is long and slender shape.
2. Its skin is slimy and covered with mucus, which helps to move in water.
3. Eel has an electric induction organ, which can sense the weak electric field in the surrounding environment.
The use of Calcitonin:
1. For the treatment of osteoporosis: Calcitonin can slow down the rate of bone loss by inhibiting the activity of bone resorption cells in the bone, and increase bone density to a certain extent.
2. For the treatment of hypercalcemia: Calcitonin can inhibit the release of calcium ions in the body, reduce the release of calcium in the bones into the blood, thereby reducing the blood calcium concentration.
3. For the treatment of hyperparathyroidism: Calcitonin can inhibit parathyroid secretion of parathyroid hormone, thereby regulating the level of calcium ions in the body.
The preparation method of Calcitonin can be obtained by artificial synthesis, or extracted and purified from the thyroid gland of animals (such as pigs and cattle).
Regarding the safety information of Calcitonin, long-term use of higher doses of Calcitonin may cause some side effects, such as facial flushing, headache, nausea and vomiting. For specific patients, such as pregnant women, lactating women and the presence of other diseases, should be used with caution. It is recommended to use Calcitonin under the guidance of a professional doctor and follow its accurate usage and precautions.
Last Update：2024-04-09 21:54:55
Supplier List
Spot supply
Product Name: Calcitonin, eel Request for quotationCAS: 57014-02-5
Tel: 400-968-2212
Email: 3623107365@qq.com
Mobile: 18916960931
QQ: 3623107365
Wechat: 18916960931
Spot supply
Product Name: Calcitonin, eel Visit Supplier Webpage Request for quotationCAS: 57014-02-5
Tel: +86-400-900-4166
Email: product@acmec-e.com
Mobile: +86-18621343501
QQ: 2881950922
Wechat: 18621343501
WhatsApp: +86-18621343501
Multiple SpecificationsSpot supply
Product Name: Calcitonin, eel Visit Supplier Webpage Request for quotationCAS: 57014-02-5
Tel: 609-228-6898
Email: sales@medchemexpress.com
tech@medchemexpress.com
Mobile: 609-228-6898
Spot supply
Product Name: Calcitonin eel Visit Supplier Webpage Request for quotationCAS: 57014-02-5
Tel: +16314854226
Email: info@bocsci.com
Mobile: +16314854226
Linkedin: https://www.linkedin.com/company/boc-sciences
Product List: View Catalog
Spot supply
Product Name: Elcatonin Visit Supplier Webpage Request for quotationCAS: 57014-02-5
Tel: +86 0571-86722205
Email: sales@chinaskyrun.com
Mobile: +8618958170122
QQ: 2531159185
Wechat: chinaskyrun
Spot supply
Product Name: Calcitonin, eel Visit Supplier Webpage Request for quotationCAS: 57014-02-5
Tel: 18301782025
Email: 3008007409@qq.com
Mobile: 18021002903
QQ: 3008007409
Spot supply
Product Name: Calcitonin, eel Request for quotationCAS: 57014-02-5
Tel: 400-968-2212
Email: 3623107365@qq.com
Mobile: 18916960931
QQ: 3623107365
Wechat: 18916960931
Spot supply
Product Name: Calcitonin, eel Visit Supplier Webpage Request for quotationCAS: 57014-02-5
Tel: +86-400-900-4166
Email: product@acmec-e.com
Mobile: +86-18621343501
QQ: 2881950922
Wechat: 18621343501
WhatsApp: +86-18621343501
Multiple SpecificationsSpot supply
Product Name: Calcitonin, eel Visit Supplier Webpage Request for quotationCAS: 57014-02-5
Tel: 609-228-6898
Email: sales@medchemexpress.com
tech@medchemexpress.com
Mobile: 609-228-6898
Spot supply
Product Name: Calcitonin eel Visit Supplier Webpage Request for quotationCAS: 57014-02-5
Tel: +16314854226
Email: info@bocsci.com
Mobile: +16314854226
Linkedin: https://www.linkedin.com/company/boc-sciences
Product List: View Catalog
Spot supply
Product Name: Elcatonin Visit Supplier Webpage Request for quotationCAS: 57014-02-5
Tel: +86 0571-86722205
Email: sales@chinaskyrun.com
Mobile: +8618958170122
QQ: 2531159185
Wechat: chinaskyrun
Spot supply
Product Name: Calcitonin, eel Visit Supplier Webpage Request for quotationCAS: 57014-02-5
Tel: 18301782025
Email: 3008007409@qq.com
Mobile: 18021002903
QQ: 3008007409
View History