83930-13-6

Name	GRF (1-44) (HUMAN)
Synonyms	SOMATORELIN SERMORELIN (HUMAN) GRF (1-44) (HUMAN) SOMATOCRININ (HUMAN) SOMATOLIBERIN (HUMAN) YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 SoMatoliberin (huMan), SoMatocrinin (huMan), SoMatorelin (huMan), Growth HorMone-Releasing Factor (huMan), Growth HorMone-Releasing HorMone (huMan), GHRH (huMan), SoMatorelin TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-NH2 GRF (huMan) SoMatoliberin (huMan), SoMatocrinin (huMan), SoMatorelin (huMan), Growth HorMone-Releasing Factor (huMan), Growth HorMone-Releasing HorMone (huMan), GHRH (huMan), SoMatorelin
CAS	83930-13-6

Molecular Formula	C215H358N72O66S
Molar Mass	5039.65082
Appearance	powder
Storage Condition	−20°C
In vitro study	The GHRHR is a member of the class II B GPCR family, which couples predominantly to the Gs-adenylate cyclase-cAMP signaling pathway. Peptide hormones that activate class II GPCRs include GHRH, secretin, glucagon-like peptides, gastric-inhibitory peptide (GIP), pituitary adenylate cyclase-activating peptide, corticotropin-releasing hormone, vasoactive intestinal peptide, parathyroid hormone, and calcitonin-related peptides. GHRH, expressed in the arcuate nucleus of the hypothalamus and released into portal vasculature, directly stimulates growth hormone synthesis and secretion from the pituitary somatotropes by activating the corresponding GHRH receptors.

WGK Germany

Spot supply

Product Name: Human growth hormone-releasing factor Request for quotation
CAS: 83930-13-6
Tel: 400-968-2212
Email: 3623107365@qq.com
Mobile: 18916960931
QQ: 3623107365

Wechat: 18916960931

Spot supply

Product Name: Human growth hormone-releasing factor Visit Supplier Webpage Request for quotation
CAS: 83930-13-6
Tel: +86-400-900-4166
Email: product@acmec-e.com
Mobile: +86-18621343501
QQ: 2881950922

Wechat: 18621343501
WhatsApp: +86-18621343501

Spot supply

Product Name: Human growth hormone-releasing factor Visit Supplier Webpage Request for quotation
CAS: 83930-13-6
Tel: 609-228-6898
Email: sales@medchemexpress.com
　　　　 tech@medchemexpress.com
Mobile: 609-228-6898

Spot supply

Product Name: Human growth hormone-releasing factor Request for quotation
CAS: 83930-13-6
Tel: 400-968-2212
Email: 3623107365@qq.com
Mobile: 18916960931
QQ: 3623107365

Wechat: 18916960931

Spot supply

Wechat: 18621343501
WhatsApp: +86-18621343501

Spot supply

View History

83930-13-6 Request for Quotation