LL-37, Human BOC Sciences

To: BOC Sciences <info@bocsci.com>
Subject
Quantity

Deliver to

My Contact
Your Message (Optional)


Supplier Name	BOC Sciences
Contact	Linna Green
Tel	+16314854226
Mobile	+16314854226
QQ
Email	info@bocsci.com
Website	https://www.bocsci.com/
Wechat
LinkedIn	https://www.linkedin.com/company/boc-sciences

Product Name	LL-37
Synonyms	CAMP LL37 LL-37 hCAP18 Protein Antibacterial LL-37, LL37, CAMP Synonyms CAMP LL37 LL-37 hCAP18 Protein Antibacterial LL-37, LL37, CAMP LL-37 human acetate Cathelicidin LL 37 (human) LL-37 (trifluoroacetate salt) Antibacterial Protein LL-37 (human) [LL-37, 37 aa] Antibacterial Protein LL-37 (huMan), LL37, CAMP H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
CAS	154947-66-7
EINECS	211-519-9
Chemical Formula	C205H340N60O53
Molecular Weight	4493.33
inchi
Package	1 mg
Price	$199
Descriptions	LL-37, Human LL-37 is a cationic and α-helical antimicrobial peptide. It can inhibit growth of Gram-positive E. coli D21 and Gram-negative B. megatarium in a concentration-dependent manner. LL-37 can promote wound healing following skin-targeted electroporation of a plasmid encoding hCAP-18/LL-37 in mice.
Supplier Website	https://aapep.bocsci.com/product/ll-37-human-cas-154947-66-7-169481.html
Last Update	2025-04-30 11:27:47

Category: Others
CAS: 1159408-54-4
Last Update: 2025-04-30 11:27:47

Category: Others
CAS: 187389-52-2
Last Update: 2025-04-30 11:27:47

Category: Others
CAS: 141758-74-9
Last Update: 2025-04-30 11:27:47

Category: Others
CAS: 108320-89-4
Last Update: 2025-04-30 11:27:47

Category: Others
CAS: 2023788-19-2
Last Update: 2025-04-30 11:27:47

Category: Others
CAS: 51481-10-8
Last Update: 2025-04-30 11:27:47

Category: Others
CAS: 946414-94-4
Last Update: 2025-04-30 11:27:47

Category: Others
CAS: 864731-61-3
Last Update: 2025-04-30 11:27:47